PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.303440.1
Common NameCsa_5G152790, LOC105435439
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 324aa    MW: 36414.8 Da    PI: 6.4415
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.303440.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.5e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G g+W+ ++++ g+ R++k+c++rw +yl
   Cucsa.303440.1 14 RGLWSPEEDEKLIRYITTHGYGCWSEVPEKAGLQRCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding53.26.8e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr+T+eE++l++ ++   G++ W+ Ia++++ gRt++++k++w+++
   Cucsa.303440.1  67 RGRFTPEEEKLIISLHGVVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111
                      89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-25664IPR009057Homeodomain-like
PROSITE profilePS5129417.264961IPR017930Myb domain
SuperFamilySSF466894.12E-3011108IPR009057Homeodomain-like
SMARTSM007171.9E-121363IPR001005SANT/Myb domain
PfamPF002492.4E-151461IPR001005SANT/Myb domain
CDDcd001673.48E-111761No hitNo description
PROSITE profilePS5129425.71262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-2565116IPR009057Homeodomain-like
SMARTSM007171.9E-1666114IPR001005SANT/Myb domain
PfamPF002491.6E-1567111IPR001005SANT/Myb domain
CDDcd001671.19E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901430Biological Processpositive regulation of syringal lignin biosynthetic process
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKRGLWSPE EDEKLIRYIT THGYGCWSEV PEKAGLQRCG KSCRLRWINY  60
LRPDIRRGRF TPEEEKLIIS LHGVVGNRWA HIASHLPGRT DNEIKNYWNS WIKKKIRKPN  120
STTPTISTTT TVTSTTNTEQ IQLSSNPHQL NFLTQDLTTK QLSLHQETLF PALSCPLFMF  180
DTSSQELFHD YSLSLNSDTT WHMNHHNHPF PTAVLSPQMG LTAATTTVMN NTNNYLPPLI  240
ENIESLVTME DEGEMALQCL QRQELNEWVV ESTTQPQNSN FLFWENVEGS LGGEEIIAPS  300
SNATIGGGGG ANTLSSSNFP TSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818950.0LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005.
GenBankLN7132630.0LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011654724.10.0PREDICTED: transcription factor MYB86
TrEMBLA0A0A0KMI20.0A0A0A0KMI2_CUCSA; Uncharacterized protein
STRINGPOPTR_0003s13190.11e-136(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41123358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.16e-95myb domain protein 103
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]